SCOP 1.61: Domain d3pvib_: 3pvi B:

Lineage for d3pvib_ (3pvi B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (6 PDB entries)

8. Domain d3pvib_: 3pvi B: [33301]

Details for d3pvib_

PDB Entry: 3pvi, 1.59 Å

PDB Description: d34g mutant of pvuii endonuclease complexed with cognate dna shows that asp34 is directly involved in dna recognition and indirectly involved in catalysis

SCOP Domain Sequences for d3pvib_:

Sequence; same for both SEQRES and ATOM records:

>d3pvib_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqgnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

Timeline for d3pvib_:

• d3pvib_ first appeared (with stable ids) in SCOP 1.55
  
• d3pvib_ appears in SCOP 1.59
  
• d3pvib_ appears in SCOP 1.63
  
• d3pvib_ appears in the current release, SCOPe 2.08