| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
| Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins) automatically mapped to Pfam PF09225 |
| Protein Restriction endonuclease PvuII [52997] (1 species) |
| Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries) |
| Domain d3pvib_: 3pvi B: [33301] protein/DNA complex; mutant |
PDB Entry: 3pvi (more details), 1.59 Å
SCOPe Domain Sequences for d3pvib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvib_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqgnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
Timeline for d3pvib_: