Lineage for d3pvia_ (3pvi A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490264Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins)
    automatically mapped to Pfam PF09225
  6. 2490265Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 2490266Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)
  8. 2490267Domain d3pvia_: 3pvi A: [33300]
    protein/DNA complex; mutant

Details for d3pvia_

PDB Entry: 3pvi (more details), 1.59 Å

PDB Description: d34g mutant of pvuii endonuclease complexed with cognate dna shows that asp34 is directly involved in dna recognition and indirectly involved in catalysis
PDB Compounds: (A:) protein (pvuii endonuclease)

SCOPe Domain Sequences for d3pvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvia_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqgnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOPe Domain Coordinates for d3pvia_:

Click to download the PDB-style file with coordinates for d3pvia_.
(The format of our PDB-style files is described here.)

Timeline for d3pvia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3pvib_