Lineage for d3pvia_ (3pvi A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24772Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 24773Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) (S)
  5. 24860Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)
  6. 24861Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 24862Species Proteus vulgaris [TaxId:585] [52998] (6 PDB entries)
  8. 24863Domain d3pvia_: 3pvi A: [33300]

Details for d3pvia_

PDB Entry: 3pvi (more details), 1.59 Å

PDB Description: d34g mutant of pvuii endonuclease complexed with cognate dna shows that asp34 is directly involved in dna recognition and indirectly involved in catalysis

SCOP Domain Sequences for d3pvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvia_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqgnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOP Domain Coordinates for d3pvia_:

Click to download the PDB-style file with coordinates for d3pvia_.
(The format of our PDB-style files is described here.)

Timeline for d3pvia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3pvib_