Lineage for d5j4qa_ (5j4q A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2387820Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 2387821Species Cow (Bos taurus) [TaxId:9913] [50523] (60 PDB entries)
    Uniprot P00766
  8. 2387901Domain d5j4qa_: 5j4q A: [332985]
    Other proteins in same PDB: d5j4qb_
    automated match to d1k2i1_

Details for d5j4qa_

PDB Entry: 5j4q (more details), 2.3 Å

PDB Description: alpha-chymotrypsin from bovine pancreas in complex with bowman-birk inhibitor from soybean
PDB Compounds: (A:) chymotrypsinogen a

SCOPe Domain Sequences for d5j4qa_:

Sequence, based on SEQRES records: (download)

>d5j4qa_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d5j4qa_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

SCOPe Domain Coordinates for d5j4qa_:

Click to download the PDB-style file with coordinates for d5j4qa_.
(The format of our PDB-style files is described here.)

Timeline for d5j4qa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5j4qb_