PDB entry 5j4q

View 5j4q on RCSB PDB site
Description: alpha-chymotrypsin from bovine pancreas in complex with Bowman-Birk inhibitor from soybean
Class: hydrolase
Keywords: protease inhibitor, protease, hydrolase
Deposited on 2016-04-01, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j4qa_
  • Chain 'B':
    Compound: bowman-birk type proteinase inhibitor
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j4qb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j4qA (A:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j4qA (A:)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
    sasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdamicag
    asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j4qB (B:)
    ddesskpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcye
    pckpseddken
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j4qB (B:)
    pccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcyepckpse
    ddke