Lineage for d1d2ia_ (1d2i A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994432Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 994433Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 994527Family c.52.1.5: Restriction endonuclease BglII [52993] (1 protein)
  6. 994528Protein Restriction endonuclease BglII [52994] (1 species)
  7. 994529Species Bacillus subtilis [TaxId:1423] [52995] (3 PDB entries)
  8. 994532Domain d1d2ia_: 1d2i A: [33297]
    protein/DNA complex; complexed with mg

Details for d1d2ia_

PDB Entry: 1d2i (more details), 1.7 Å

PDB Description: crystal structure of restriction endonuclease bglii complexed with dna 16-mer
PDB Compounds: (A:) protein (restriction endonuclease bglii)

SCOPe Domain Sequences for d1d2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ia_ c.52.1.5 (A:) Restriction endonuclease BglII {Bacillus subtilis [TaxId: 1423]}
mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
vsttyadkrysrtitkrdtvkgkvidtntpntrrrkrgtivty

SCOPe Domain Coordinates for d1d2ia_:

Click to download the PDB-style file with coordinates for d1d2ia_.
(The format of our PDB-style files is described here.)

Timeline for d1d2ia_: