SCOPe 2.08: Domain d1d2ia_: 1d2i A:

Lineage for d1d2ia_ (1d2i A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.5: Restriction endonuclease BglII [52993] (1 protein)

6. Protein Restriction endonuclease BglII [52994] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [52995] (3 PDB entries)

8. Domain d1d2ia_: 1d2i A: [33297]
   protein/DNA complex; complexed with mg

Details for d1d2ia_

PDB Entry: 1d2i, 1.7 Å

PDB Description: crystal structure of restriction endonuclease bglii complexed with dna 16-mer

PDB Compounds: (A:) protein (restriction endonuclease bglii)

SCOPe Domain Sequences for d1d2ia_:

Sequence; same for both SEQRES and ATOM records:

>d1d2ia_ c.52.1.5 (A:) Restriction endonuclease BglII {Bacillus subtilis [TaxId: 1423]}
mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
vsttyadkrysrtitkrdtvkgkvidtntpntrrrkrgtivty

Timeline for d1d2ia_:

• d1d2ia_ first appeared (with stable ids) in SCOP 1.55
  
• d1d2ia_ appears in SCOPe 2.07