SCOPe 2.08: Domain d5mgea1: 5mge A:1858-1971

Lineage for d5mgea1 (5mge A:1858-1971)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5mgea1: 5mge A:1858-1971 [332966]
   Other proteins in same PDB: d5mgea2
   automated match to d3uv2a_
   complexed with 7mx

Details for d5mgea1

PDB Entry: 5mge, 1.95 Å

PDB Description: crystal structure of baz2b bromodomain in complex with 1- methylpyridine derivative 1

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d5mgea1:

Sequence; same for both SEQRES and ATOM records:

>d5mgea1 a.29.2.0 (A:1858-1971) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv

Timeline for d5mgea1:

• d5mgea1 first appeared in SCOPe 2.06
  
• d5mgea1 appears in SCOPe 2.07