SCOPe 2.08: Domain d4rvea_: 4rve A:

Lineage for d4rvea_ (4rve A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
   automatically mapped to Pfam PF09233

6. Protein Restriction endonuclease EcoRV [52985] (1 species)

7. Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)

8. Domain d4rvea_: 4rve A: [33280]
   protein/DNA complex

Details for d4rvea_

PDB Entry: 4rve, 3 Å

PDB Description: the crystal structure of ecorv endonuclease and of its complexes with cognate and non-cognate dna segments

PDB Compounds: (A:) protein (eco rv (e.c.3.1.21.4))

SCOPe Domain Sequences for d4rvea_:

Sequence; same for both SEQRES and ATOM records:

>d4rvea_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy

Timeline for d4rvea_:

• d4rvea_ first appeared (with stable ids) in SCOP 1.55
  
• d4rvea_ appears in SCOPe 2.07