Lineage for d1b96b_ (1b96 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994432Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 994433Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 994449Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
  6. 994450Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 994451Species Escherichia coli [TaxId:562] [52986] (29 PDB entries)
  8. 994495Domain d1b96b_: 1b96 B: [33269]
    protein/DNA complex; mutant

Details for d1b96b_

PDB Entry: 1b96 (more details), 2.3 Å

PDB Description: analysis of a mutational hot-spot in the ecorv restriction endonuclease: a catalytic role for a main chain carbonyl group
PDB Compounds: (B:) restriction endonuclease ecorv

SCOPe Domain Sequences for d1b96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b96b_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqenhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOPe Domain Coordinates for d1b96b_:

Click to download the PDB-style file with coordinates for d1b96b_.
(The format of our PDB-style files is described here.)

Timeline for d1b96b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b96a_