Lineage for d1buaa_ (1bua A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170597Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1170598Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1170614Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
  6. 1170615Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 1170616Species Escherichia coli [TaxId:562] [52986] (29 PDB entries)
  8. 1170649Domain d1buaa_: 1bua A: [33266]
    protein/DNA complex

Details for d1buaa_

PDB Entry: 1bua (more details), 2.15 Å

PDB Description: structural and energetic origins of indirect readout in site-specific dna cleavage by a restriction endonuclease
PDB Compounds: (A:) endonuclease ecorv

SCOPe Domain Sequences for d1buaa_:

Sequence, based on SEQRES records: (download)

>d1buaa_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgr

Sequence, based on observed residues (ATOM records): (download)

>d1buaa_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepqqnhypdftlykpsepnkkiaidikttytekikftlggytsfirnntknivypfd
qyiahwiigyvytrvktyninelneipkpykgvkvflqdkwviagdlagsgnttnigsih
ahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgr

SCOPe Domain Coordinates for d1buaa_:

Click to download the PDB-style file with coordinates for d1buaa_.
(The format of our PDB-style files is described here.)

Timeline for d1buaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1buab_