SCOPe 2.06: Domain d5k7pa_: 5k7p A:

Lineage for d5k7pa_ (5k7p A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (19 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Hypocrea jecorina [TaxId:51453] [277348] (4 PDB entries)

8. Domain d5k7pa_: 5k7p A: [332549]
   automated match to d3aksa_
   complexed with iod

Details for d5k7pa_

PDB Entry: 5k7p, 2.3 Å

PDB Description: microed structure of xylanase at 2.3 a resolution

PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d5k7pa_:

Sequence; same for both SEQRES and ATOM records:

>d5k7pa_ b.29.1.11 (A:) Xylanase II {Hypocrea jecorina [TaxId: 51453]}
qtiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d5k7pa_:

• d5k7pa_ is new in SCOPe 2.06-stable
  
• d5k7pa_ appears in SCOPe 2.07
  
• d5k7pa_ appears in the current release, SCOPe 2.08