Lineage for d5k7pa_ (5k7p A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780186Species Hypocrea jecorina [TaxId:51453] [277348] (4 PDB entries)
  8. 2780192Domain d5k7pa_: 5k7p A: [332549]
    automated match to d3aksa_
    complexed with iod

Details for d5k7pa_

PDB Entry: 5k7p (more details), 2.3 Å

PDB Description: microed structure of xylanase at 2.3 a resolution
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d5k7pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k7pa_ b.29.1.11 (A:) Xylanase II {Hypocrea jecorina [TaxId: 51453]}
qtiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d5k7pa_:

Click to download the PDB-style file with coordinates for d5k7pa_.
(The format of our PDB-style files is described here.)

Timeline for d5k7pa_: