![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
![]() | Protein automated matches [190615] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
![]() | Domain d5pg6a1: 5pg6 A:1858-1970 [332105] Other proteins in same PDB: d5pg6a2 automated match to d3uv2a_ complexed with edo |
PDB Entry: 5pg6 (more details), 1.65 Å
SCOPe Domain Sequences for d5pg6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5pg6a1 a.29.2.0 (A:1858-1970) automated matches {Human (Homo sapiens) [TaxId: 9606]} svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk
Timeline for d5pg6a1: