SCOP 1.63: Domain d1evka1: 1evk A:533-642

Lineage for d1evka1 (1evk A:533-642)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (1 species)

7. Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)

8. Domain d1evka1: 1evk A:533-642 [33208]
   Other proteins in same PDB: d1evka2, d1evkb2

Details for d1evka1

PDB Entry: 1evk, 2 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with the ligand threonine

SCOP Domain Sequences for d1evka1:

Sequence; same for both SEQRES and ATOM records:

>d1evka1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

Timeline for d1evka1:

• d1evka1 first appeared (with stable ids) in SCOP 1.55
  
• d1evka1 appears in SCOP 1.61
  
• d1evka1 appears in SCOP 1.65
  
• d1evka1 appears in the current release, SCOPe 2.08