Lineage for d1evka1 (1evk A:533-642)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181602Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 181603Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 181604Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 181664Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (1 species)
  7. 181665Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)
  8. 181673Domain d1evka1: 1evk A:533-642 [33208]
    Other proteins in same PDB: d1evka2, d1evkb2

Details for d1evka1

PDB Entry: 1evk (more details), 2 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with the ligand threonine

SCOP Domain Sequences for d1evka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evka1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

SCOP Domain Coordinates for d1evka1:

Click to download the PDB-style file with coordinates for d1evka1.
(The format of our PDB-style files is described here.)

Timeline for d1evka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1evka2