Lineage for d1ggma1 (1ggm A:395-505)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245573Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 245574Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 245575Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 245576Protein Glycyl-tRNA synthetase (GlyRS), C-terminal domain [52960] (1 species)
  7. 245577Species Thermus thermophilus [TaxId:274] [52961] (3 PDB entries)
  8. 245582Domain d1ggma1: 1ggm A:395-505 [33200]
    Other proteins in same PDB: d1ggma2, d1ggmb2

Details for d1ggma1

PDB Entry: 1ggm (more details), 3.4 Å

PDB Description: glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate

SCOP Domain Sequences for d1ggma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggma1 c.51.1.1 (A:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus}
qlapikvaviplvknrpeiteyakrlkarllalglgrvlyedtgnigkayrrhdevgtpf
avtvdydtigqskdgttrlkdtvtvrdrdtmeqirlhvdelegflrerlrw

SCOP Domain Coordinates for d1ggma1:

Click to download the PDB-style file with coordinates for d1ggma1.
(The format of our PDB-style files is described here.)

Timeline for d1ggma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ggma2