Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) |
Protein Glycyl-tRNA synthetase (GlyRS), C-terminal domain [52960] (1 species) |
Species Thermus thermophilus [TaxId:274] [52961] (3 PDB entries) |
Domain d1ggma1: 1ggm A:395-505 [33200] Other proteins in same PDB: d1ggma2, d1ggmb2 |
PDB Entry: 1ggm (more details), 3.4 Å
SCOP Domain Sequences for d1ggma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggma1 c.51.1.1 (A:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus} qlapikvaviplvknrpeiteyakrlkarllalglgrvlyedtgnigkayrrhdevgtpf avtvdydtigqskdgttrlkdtvtvrdrdtmeqirlhvdelegflrerlrw
Timeline for d1ggma1: