Lineage for d1atib1 (1ati B:395-505)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181602Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 181603Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 181604Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 181619Protein Glycyl-tRNA synthetase (GlyRS), C-terminal domain [52960] (1 species)
  7. 181620Species Thermus thermophilus [TaxId:274] [52961] (3 PDB entries)
  8. 181622Domain d1atib1: 1ati B:395-505 [33197]
    Other proteins in same PDB: d1atia2, d1atib2

Details for d1atib1

PDB Entry: 1ati (more details), 2.75 Å

PDB Description: crystal structure of glycyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1atib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atib1 c.51.1.1 (B:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus}
qlapikvaviplvknrpeiteyakrlkarllalglgrvlyedtgnigkayrrhdevgtpf
avtvdydtigqskdgttrlkdtvtvrdrdtmeqirlhvdelegflrerlrw

SCOP Domain Coordinates for d1atib1:

Click to download the PDB-style file with coordinates for d1atib1.
(The format of our PDB-style files is described here.)

Timeline for d1atib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1atib2