| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) |
| Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species) |
| Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries) |
| Domain d1adyc1: 1ady C:326-421 [33194] Other proteins in same PDB: d1adya2, d1adyb2, d1adyc2, d1adyd2 |
PDB Entry: 1ady (more details), 2.8 Å
SCOP Domain Sequences for d1adyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adyc1 c.51.1.1 (C:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg
Timeline for d1adyc1: