SCOP 1.65: Domain d1adya1: 1ady A:326-421

Lineage for d1adya1 (1ady A:326-421)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)

7. Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries)

8. Domain d1adya1: 1ady A:326-421 [33192]
   Other proteins in same PDB: d1adya2, d1adyb2, d1adyc2, d1adyd2

Details for d1adya1

PDB Entry: 1ady, 2.8 Å

PDB Description: histidyl-trna synthetase in complex with histidyl-adenylate

SCOP Domain Sequences for d1adya1:

Sequence; same for both SEQRES and ATOM records:

>d1adya1 c.51.1.1 (A:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg

Timeline for d1adya1:

• d1adya1 first appeared (with stable ids) in SCOP 1.55
  
• d1adya1 appears in SCOP 1.63
  
• d1adya1 appears in SCOP 1.67
  
• d1adya1 appears in the current release, SCOPe 2.08