Lineage for d1adyc1 (1ady C:326-421)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24691Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 24692Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 24693Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (3 proteins)
  6. 24702Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)
  7. 24719Species Thermus thermophilus [TaxId:274] [52959] (2 PDB entries)
  8. 24726Domain d1adyc1: 1ady C:326-421 [33194]
    Other proteins in same PDB: d1adya2, d1adyb2, d1adyc2, d1adyd2

Details for d1adyc1

PDB Entry: 1ady (more details), 2.8 Å

PDB Description: histidyl-trna synthetase in complex with histidyl-adenylate

SCOP Domain Sequences for d1adyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adyc1 c.51.1.1 (C:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg

SCOP Domain Coordinates for d1adyc1:

Click to download the PDB-style file with coordinates for d1adyc1.
(The format of our PDB-style files is described here.)

Timeline for d1adyc1: