![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) |
![]() | Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
![]() | Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (3 proteins) |
![]() | Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52959] (2 PDB entries) |
![]() | Domain d1adyc1: 1ady C:326-421 [33194] Other proteins in same PDB: d1adya2, d1adyb2, d1adyc2, d1adyd2 |
PDB Entry: 1ady (more details), 2.8 Å
SCOP Domain Sequences for d1adyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adyc1 c.51.1.1 (C:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus} ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg edelragevtlkrlatgeqvrlsreevpgyllqalg
Timeline for d1adyc1: