| Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) |
| Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species) |
| Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries) |
| Domain d1adjb1: 1adj B:326-421 [33189] Other proteins in same PDB: d1adja2, d1adjb2, d1adjc2, d1adjd2 |
PDB Entry: 1adj (more details), 2.7 Å
SCOP Domain Sequences for d1adjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adjb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg
Timeline for d1adjb1: