Lineage for d1adja1 (1adj A:326-421)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123878Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 123879Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 123880Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 123903Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)
  7. 123920Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries)
  8. 123922Domain d1adja1: 1adj A:326-421 [33188]
    Other proteins in same PDB: d1adja2, d1adjb2, d1adjc2, d1adjd2

Details for d1adja1

PDB Entry: 1adj (more details), 2.7 Å

PDB Description: histidyl-trna synthetase in complex with histidine

SCOP Domain Sequences for d1adja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adja1 c.51.1.1 (A:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg

SCOP Domain Coordinates for d1adja1:

Click to download the PDB-style file with coordinates for d1adja1.
(The format of our PDB-style files is described here.)

Timeline for d1adja1: