Lineage for d5ws6c_ (5ws6 c:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256467Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 2256468Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 2256469Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 2256485Protein automated matches [191285] (3 species)
    not a true protein
  7. 2256493Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (15 PDB entries)
  8. 2256516Domain d5ws6c_: 5ws6 c: [331597]
    Other proteins in same PDB: d5ws6a_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6v_, d5ws6x_, d5ws6z_
    automated match to d5b66c_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6c_

PDB Entry: 5ws6 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset
PDB Compounds: (c:) Photosystem II CP43 chlorophyll protein

SCOPe Domain Sequences for d5ws6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws6c_ f.55.1.1 (c:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
nsifatnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipe
kpmyeqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpe
tleeyssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrv
itnptldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfg
warrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtfl
irdqklganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldln
kikndiqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlafffl
vghlwhagraraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d5ws6c_:

Click to download the PDB-style file with coordinates for d5ws6c_.
(The format of our PDB-style files is described here.)

Timeline for d5ws6c_: