Lineage for d5ws6e_ (5ws6 e:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254945Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2254946Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2254970Protein automated matches [191000] (4 species)
    not a true protein
  7. 2254988Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (9 PDB entries)
  8. 2254997Domain d5ws6e_: 5ws6 e: [331507]
    Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6v_, d5ws6x_, d5ws6z_
    automated match to d2axte1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6e_

PDB Entry: 5ws6 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset
PDB Compounds: (e:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d5ws6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws6e_ f.23.38.1 (e:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
gerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsipl
vtdrfeakqqvetfleqlk

SCOPe Domain Coordinates for d5ws6e_:

Click to download the PDB-style file with coordinates for d5ws6e_.
(The format of our PDB-style files is described here.)

Timeline for d5ws6e_: