SCOPe 2.08: Domain d5ws6j_: 5ws6 j:

Lineage for d5ws6j_ (5ws6 j:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families)
   automatically mapped to Pfam PF01788

5. Family f.23.32.1: PsbJ-like [161022] (2 proteins)
   Pfam PF01788

6. Protein automated matches [191002] (3 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries)

8. Domain d5ws6j_: 5ws6 j: [331589]
   Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6v_, d5ws6x_, d5ws6z_
   automated match to d5b5ej_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6j_

PDB Entry: 5ws6, 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset

PDB Compounds: (j:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5ws6j_:

Sequence; same for both SEQRES and ATOM records:

>d5ws6j_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mseggriplwivatvagmgvivivglffygayaglgssl

Timeline for d5ws6j_:

• d5ws6j_ first appeared in SCOPe 2.06
  
• d5ws6j_ appears in SCOPe 2.07