Lineage for d1e0uc3 (1e0u C:354-470)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181484Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 181485Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 181486Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 181487Protein Pyruvate kinase, C-terminal domain [52937] (5 species)
  7. 181495Species Escherichia coli [TaxId:562] [52942] (3 PDB entries)
  8. 181506Domain d1e0uc3: 1e0u C:354-470 [33156]
    Other proteins in same PDB: d1e0ua1, d1e0ua2, d1e0ub1, d1e0ub2, d1e0uc1, d1e0uc2, d1e0ud1, d1e0ud2

Details for d1e0uc3

PDB Entry: 1e0u (more details), 2.8 Å

PDB Description: structure r271l mutant of e. coli pyruvate kinase

SCOP Domain Sequences for d1e0uc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0uc3 c.49.1.1 (C:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli}
iteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlsk
gvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl

SCOP Domain Coordinates for d1e0uc3:

Click to download the PDB-style file with coordinates for d1e0uc3.
(The format of our PDB-style files is described here.)

Timeline for d1e0uc3: