Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) |
Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) automatically mapped to Pfam PF02887 |
Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
Species Escherichia coli [TaxId:562] [52942] (3 PDB entries) |
Domain d1e0uc3: 1e0u C:354-470 [33156] Other proteins in same PDB: d1e0ua1, d1e0ua2, d1e0ub1, d1e0ub2, d1e0uc1, d1e0uc2, d1e0ud1, d1e0ud2 complexed with so4; mutant |
PDB Entry: 1e0u (more details), 2.8 Å
SCOPe Domain Sequences for d1e0uc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0uc3 c.49.1.1 (C:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli [TaxId: 562]} iteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlsk gvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
Timeline for d1e0uc3: