Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
Domain d5uaxd2: 5uax D:165-269 [331558] Other proteins in same PDB: d5uaxa1, d5uaxa3, d5uaxb1, d5uaxb3, d5uaxc1, d5uaxc3, d5uaxd1, d5uaxd3, d5uaxe1 automated match to d2izzc2 complexed with cl |
PDB Entry: 5uax (more details), 1.85 Å
SCOPe Domain Sequences for d5uaxd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uaxd2 a.100.1.0 (D:165-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelq
Timeline for d5uaxd2: