Lineage for d5us1h_ (5us1 H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2209956Species Providencia stuartii [TaxId:588] [331391] (1 PDB entry)
  8. 2209964Domain d5us1h_: 5us1 H: [331455]
    Other proteins in same PDB: d5us1a2, d5us1c2, d5us1e2, d5us1j2, d5us1k2
    automated match to d1m44a_
    complexed with 8mm, aco, coa, gol, tar

Details for d5us1h_

PDB Entry: 5us1 (more details), 2.48 Å

PDB Description: crystal structure of aminoglycoside acetyltransferase aac(2')-ia in complex with n2'-acetylgentamicin c1a and coenzyme a
PDB Compounds: (H:) Aminoglycoside 2'-N-acetyltransferase

SCOPe Domain Sequences for d5us1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5us1h_ d.108.1.0 (H:) automated matches {Providencia stuartii [TaxId: 588]}
mgieyrslhtsqltlsekealydlliegfegdfshddfahtlggmhvmafdqqklvghva
iiqrhmaldntpisvgyveamvveqsyrrqgigrqlmlqtnkiiascyqlgllsasddgq
klyhsvgwqiwkgklfelkqgsyirsieeeggvmgwkadgevdftaslycdfrggdqw

SCOPe Domain Coordinates for d5us1h_:

Click to download the PDB-style file with coordinates for d5us1h_.
(The format of our PDB-style files is described here.)

Timeline for d5us1h_: