Lineage for d1b0pb3 (1b0p B:259-415)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1169947Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1169948Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 1170058Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein)
  6. 1170059Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species)
  7. 1170060Species Desulfovibrio africanus [TaxId:873] [52933] (10 PDB entries)
  8. 1170076Domain d1b0pb3: 1b0p B:259-415 [33105]
    Other proteins in same PDB: d1b0pa1, d1b0pa2, d1b0pa4, d1b0pa5, d1b0pb1, d1b0pb2, d1b0pb4, d1b0pb5
    complexed with ca, mg, sf4, tpp

Details for d1b0pb3

PDB Entry: 1b0p (more details), 2.31 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) protein (pyruvate-ferredoxin oxidoreductase)

SCOPe Domain Sequences for d1b0pb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0pb3 c.48.1.3 (B:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]}
klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp
asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv
ydnmsgakknhftvgieddvtgtslpvdnafadttpk

SCOPe Domain Coordinates for d1b0pb3:

Click to download the PDB-style file with coordinates for d1b0pb3.
(The format of our PDB-style files is described here.)

Timeline for d1b0pb3: