Lineage for d1b0pb1 (1b0p B:2-258)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162387Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1162388Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1162640Family c.36.1.8: PFOR Pyr module [88746] (1 protein)
    domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains
  6. 1162641Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain I [88747] (1 species)
  7. 1162642Species Desulfovibrio africanus [TaxId:873] [88748] (10 PDB entries)
  8. 1162658Domain d1b0pb1: 1b0p B:2-258 [31833]
    Other proteins in same PDB: d1b0pa2, d1b0pa3, d1b0pa4, d1b0pa5, d1b0pb2, d1b0pb3, d1b0pb4, d1b0pb5
    complexed with ca, mg, sf4, tpp

Details for d1b0pb1

PDB Entry: 1b0p (more details), 2.31 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) protein (pyruvate-ferredoxin oxidoreductase)

SCOPe Domain Sequences for d1b0pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0pb1 c.36.1.8 (B:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]}
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsy

SCOPe Domain Coordinates for d1b0pb1:

Click to download the PDB-style file with coordinates for d1b0pb1.
(The format of our PDB-style files is described here.)

Timeline for d1b0pb1: