Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
Protein automated matches [191172] (11 species) not a true protein |
Species Escherichia coli [TaxId:199310] [330683] (4 PDB entries) |
Domain d5jrdt_: 5jrd T: [330685] Other proteins in same PDB: d5jrdl_, d5jrdm_ automated match to d3rgws_ complexed with cl, f3s, fco, mg, ni, sf3, sf4, so4 |
PDB Entry: 5jrd (more details), 1.2 Å
SCOPe Domain Sequences for d5jrdt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jrdt_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 199310]} kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi qsghgclgcaengfwdrgsfysrv
Timeline for d5jrdt_: