Lineage for d3rgws_ (3rgw S:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624800Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2624801Protein automated matches [191172] (11 species)
    not a true protein
  7. 2624875Species Ralstonia eutropha [TaxId:381666] [256057] (8 PDB entries)
  8. 2624876Domain d3rgws_: 3rgw S: [239695]
    Other proteins in same PDB: d3rgwl_
    automated match to d3ayxb_
    complexed with f3s, f4s, mg, nfu, sf4

Details for d3rgws_

PDB Entry: 3rgw (more details), 1.5 Å

PDB Description: Crystal structure at 1.5 A resolution of an H2-reduced, O2-tolerant hydrogenase from Ralstonia eutropha unmasks a novel iron-sulfur cluster
PDB Compounds: (S:) Membrane-bound hydrogenase (NIFE) small subunit HOXK

SCOPe Domain Sequences for d3rgws_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rgws_ e.19.1.0 (S:) automated matches {Ralstonia eutropha [TaxId: 381666]}
prtpvlwlhglectccsesfirsahplakdvvlsmisldyddtlmaaaghqaeaileeim
tkykgnyilavegnpplnqdgmsciiggrpfieqlkyvakdakaiiswgscaswgcvqaa
kpnptqatpvhkvitdkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmfysq
rihdkcyrrphfdagqfveewddesarkgfclykmgckgpttynacsttrwnegtsfpiq
sghgcigcsedgfwdkgsfydrltgisqfg

SCOPe Domain Coordinates for d3rgws_:

Click to download the PDB-style file with coordinates for d3rgws_.
(The format of our PDB-style files is described here.)

Timeline for d3rgws_: