Lineage for d1ezka1 (1ezk A:2-146)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877832Protein Tryparedoxin I [52904] (2 species)
  7. 2877833Species Crithidia fasciculata [TaxId:5656] [52905] (8 PDB entries)
  8. 2877840Domain d1ezka1: 1ezk A:2-146 [33063]
    Other proteins in same PDB: d1ezka2

Details for d1ezka1

PDB Entry: 1ezk (more details), 1.9 Å

PDB Description: Crystal structure of recombinant tryparedoxin I
PDB Compounds: (A:) tryparedoxin I

SCOPe Domain Sequences for d1ezka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezka1 c.47.1.10 (A:2-146) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]}
sgldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfhesk
nfevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgd
vvttraratlvkdpegeqfpwkdap

SCOPe Domain Coordinates for d1ezka1:

Click to download the PDB-style file with coordinates for d1ezka1.
(The format of our PDB-style files is described here.)

Timeline for d1ezka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ezka2