Lineage for d1ezka_ (1ezk A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24524Family c.47.1.10: Glutathione peroxidase-like [52901] (5 proteins)
  6. 24554Protein Tryparedoxin I [52904] (1 species)
  7. 24555Species Crithidia fasciculata [TaxId:5656] [52905] (3 PDB entries)
  8. 24558Domain d1ezka_: 1ezk A: [33063]

Details for d1ezka_

PDB Entry: 1ezk (more details), 1.9 Å

PDB Description: Crystal structure of recombinant tryparedoxin I

SCOP Domain Sequences for d1ezka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezka_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata}
sgldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfhesk
nfevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgd
vvttraratlvkdpegeqfpwkdaplehh

SCOP Domain Coordinates for d1ezka_:

Click to download the PDB-style file with coordinates for d1ezka_.
(The format of our PDB-style files is described here.)

Timeline for d1ezka_: