Lineage for d1a0rp_ (1a0r P:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992866Family c.47.1.6: Phosducin [52888] (1 protein)
  6. 992867Protein Phosducin [52889] (2 species)
    the transducin beta subunit-binding subdomain is an irregular array of helices in the N-terminal extension
  7. 992868Species Cow (Bos taurus) [TaxId:9913] [52891] (1 PDB entry)
  8. 992869Domain d1a0rp_: 1a0r P: [33054]
    Other proteins in same PDB: d1a0rb_, d1a0rg_
    complexed with far

Details for d1a0rp_

PDB Entry: 1a0r (more details), 2.8 Å

PDB Description: heterotrimeric complex of phosducin/transducin beta-gamma
PDB Compounds: (P:) phosducin

SCOPe Domain Sequences for d1a0rp_:

Sequence, based on SEQRES records: (download)

>d1a0rp_ c.47.1.6 (P:) Phosducin {Cow (Bos taurus) [TaxId: 9913]}
fegqashtgpkgvindwrkfklesedsdsvahskkeilrqmsspqsrddkdskerfsrkm
svqeyelihkdkedenclrkyrrqcmqdmhqklsfgprygfvyelesgeqfletiekeqk
ittivvhiyedgikgcdalnssliclaaeypmvkfckikasntgagdrfssdvlptllvy
kggellsnfisvteqlaeefftgdvesflneygllpek

Sequence, based on observed residues (ATOM records): (download)

>d1a0rp_ c.47.1.6 (P:) Phosducin {Cow (Bos taurus) [TaxId: 9913]}
fegqashtgpkgvindwrkfklesefsrkmsvqeyelihkdkedenclrkyrrqcmqdmh
qklsfgprygfvyelesgeqfletiekeqkittivvhiyedgikgcdalnssliclaaey
pmvkfckikasntgagdrfssdvlptllvykggellsnfisvteqlaeefftgdvesfln
eygllpek

SCOPe Domain Coordinates for d1a0rp_:

Click to download the PDB-style file with coordinates for d1a0rp_.
(The format of our PDB-style files is described here.)

Timeline for d1a0rp_: