SCOPe 2.08: Domain d1a0rp_: 1a0r P:

Lineage for d1a0rp_ (1a0r P:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.6: Phosducin [52888] (1 protein)
   automatically mapped to Pfam PF02114

6. Protein Phosducin [52889] (2 species)
   the transducin beta subunit-binding subdomain is an irregular array of helices in the N-terminal extension

7. Species Cow (Bos taurus) [TaxId:9913] [52891] (1 PDB entry)

8. Domain d1a0rp_: 1a0r P: [33054]
   Other proteins in same PDB: d1a0rb_, d1a0rg_
   complexed with far

Details for d1a0rp_

PDB Entry: 1a0r, 2.8 Å

PDB Description: heterotrimeric complex of phosducin/transducin beta-gamma

PDB Compounds: (P:) phosducin

SCOPe Domain Sequences for d1a0rp_:

Sequence, based on SEQRES records:

>d1a0rp_ c.47.1.6 (P:) Phosducin {Cow (Bos taurus) [TaxId: 9913]}
fegqashtgpkgvindwrkfklesedsdsvahskkeilrqmsspqsrddkdskerfsrkm
svqeyelihkdkedenclrkyrrqcmqdmhqklsfgprygfvyelesgeqfletiekeqk
ittivvhiyedgikgcdalnssliclaaeypmvkfckikasntgagdrfssdvlptllvy
kggellsnfisvteqlaeefftgdvesflneygllpek

Sequence, based on observed residues (ATOM records):

>d1a0rp_ c.47.1.6 (P:) Phosducin {Cow (Bos taurus) [TaxId: 9913]}
fegqashtgpkgvindwrkfklesefsrkmsvqeyelihkdkedenclrkyrrqcmqdmh
qklsfgprygfvyelesgeqfletiekeqkittivvhiyedgikgcdalnssliclaaey
pmvkfckikasntgagdrfssdvlptllvykggellsnfisvteqlaeefftgdvesfln
eygllpek

Timeline for d1a0rp_:

• d1a0rp_ first appeared (with stable ids) in SCOP 1.55
  
• d1a0rp_ appears in SCOPe 2.07