Lineage for d5wszd_ (5wsz D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766160Species Bacillus thuringiensis [TaxId:29339] [330245] (1 PDB entry)
  8. 2766164Domain d5wszd_: 5wsz D: [330258]
    automated match to d4gboa_
    complexed with cu

Details for d5wszd_

PDB Entry: 5wsz (more details), 2.57 Å

PDB Description: crystal structure of a lytic polysaccharide monooxygenase,btlpmo10a, from bacillus thuringiensis
PDB Compounds: (D:) LpmO10A

SCOPe Domain Sequences for d5wszd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wszd_ b.1.18.0 (D:) automated matches {Bacillus thuringiensis [TaxId: 29339]}
hgyvespasrsylckqgvnvncgpiqyepqsvegiggfpqlgpsdgqiagaghfpaldvq
tvdrwkkvtlnggtntfkwkltaphstkewkyyitkkgwnpnkpltrsdldlvpfyvknd
ggarpgttvtheanvptdrsgyhlilavweiadtgnafyqvidvnlln

SCOPe Domain Coordinates for d5wszd_:

Click to download the PDB-style file with coordinates for d5wszd_.
(The format of our PDB-style files is described here.)

Timeline for d5wszd_: