![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Bacillus thuringiensis [TaxId:29339] [330245] (1 PDB entry) |
![]() | Domain d5wszd_: 5wsz D: [330258] automated match to d4gboa_ complexed with cu |
PDB Entry: 5wsz (more details), 2.57 Å
SCOPe Domain Sequences for d5wszd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wszd_ b.1.18.0 (D:) automated matches {Bacillus thuringiensis [TaxId: 29339]} hgyvespasrsylckqgvnvncgpiqyepqsvegiggfpqlgpsdgqiagaghfpaldvq tvdrwkkvtlnggtntfkwkltaphstkewkyyitkkgwnpnkpltrsdldlvpfyvknd ggarpgttvtheanvptdrsgyhlilavweiadtgnafyqvidvnlln
Timeline for d5wszd_: