Lineage for d2gsqa2 (2gsq A:1-75)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600814Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1601276Protein Class sigma GST [81362] (5 species)
  7. 1601319Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [52876] (2 PDB entries)
  8. 1601320Domain d2gsqa2: 2gsq A:1-75 [33009]
    Other proteins in same PDB: d2gsqa1
    complexed with gbi, so4

Details for d2gsqa2

PDB Entry: 2gsq (more details), 2.2 Å

PDB Description: glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2gsqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]}
pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
sqsmciarhlarefg

SCOPe Domain Coordinates for d2gsqa2:

Click to download the PDB-style file with coordinates for d2gsqa2.
(The format of our PDB-style files is described here.)

Timeline for d2gsqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsqa1