Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) |
Protein Glutathione S-transferase [52863] (22 species) |
Species Squid (Ommastrephes sloani pacificus), class sigma [52876] (2 PDB entries) |
Domain d2gsq_2: 2gsq 1-75 [33009] Other proteins in same PDB: d2gsq_1 |
PDB Entry: 2gsq (more details), 2.2 Å
SCOP Domain Sequences for d2gsq_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gsq_2 c.47.1.5 (1-75) Glutathione S-transferase {Squid (Ommastrephes sloani pacificus), class sigma} pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm sqsmciarhlarefg
Timeline for d2gsq_2: