Lineage for d2gsq_2 (2gsq 1-75)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24490Species Squid (Ommastrephes sloani pacificus), class sigma [52876] (2 PDB entries)
  8. 24491Domain d2gsq_2: 2gsq 1-75 [33009]
    Other proteins in same PDB: d2gsq_1

Details for d2gsq_2

PDB Entry: 2gsq (more details), 2.2 Å

PDB Description: glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione

SCOP Domain Sequences for d2gsq_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsq_2 c.47.1.5 (1-75) Glutathione S-transferase {Squid (Ommastrephes sloani pacificus), class sigma}
pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
sqsmciarhlarefg

SCOP Domain Coordinates for d2gsq_2:

Click to download the PDB-style file with coordinates for d2gsq_2.
(The format of our PDB-style files is described here.)

Timeline for d2gsq_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsq_1