Lineage for d3ljra2 (3ljr A:1-79)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699243Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 699682Protein Class theta GST [81361] (1 species)
  7. 699683Species Human (Homo sapiens) [TaxId:9606] [52874] (3 PDB entries)
  8. 699688Domain d3ljra2: 3ljr A:1-79 [33005]
    Other proteins in same PDB: d3ljra1, d3ljrb1

Details for d3ljra2

PDB Entry: 3ljr (more details), 3.3 Å

PDB Description: glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate
PDB Compounds: (A:) glutathione s-transferase

SCOP Domain Sequences for d3ljra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}
mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
dfiltessailiylsckyq

SCOP Domain Coordinates for d3ljra2:

Click to download the PDB-style file with coordinates for d3ljra2.
(The format of our PDB-style files is described here.)

Timeline for d3ljra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ljra1