SCOP 1.73: Domain d3ljra1: 3ljr A:80-244

Lineage for d3ljra1 (3ljr A:80-244)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class theta GST [81350] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47629] (3 PDB entries)

8. Domain d3ljra1: 3ljr A:80-244 [17711]
   Other proteins in same PDB: d3ljra2, d3ljrb2

Details for d3ljra1

PDB Entry: 3ljr, 3.3 Å

PDB Description: glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate

PDB Compounds: (A:) glutathione s-transferase

SCOP Domain Sequences for d3ljra1:

Sequence; same for both SEQRES and ATOM records:

>d3ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

Timeline for d3ljra1:

• d3ljra1 first appeared (with stable ids) in SCOP 1.55
  
• d3ljra1 appears in SCOP 1.71
  
• d3ljra1 appears in SCOP 1.75
  
• d3ljra1 appears in the current release, SCOPe 2.08