Lineage for d3ljra1 (3ljr A:80-244)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769705Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 769706Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 769707Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 770187Protein Class theta GST [81350] (1 species)
  7. 770188Species Human (Homo sapiens) [TaxId:9606] [47629] (3 PDB entries)
  8. 770193Domain d3ljra1: 3ljr A:80-244 [17711]
    Other proteins in same PDB: d3ljra2, d3ljrb2

Details for d3ljra1

PDB Entry: 3ljr (more details), 3.3 Å

PDB Description: glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate
PDB Compounds: (A:) glutathione s-transferase

SCOP Domain Sequences for d3ljra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

SCOP Domain Coordinates for d3ljra1:

Click to download the PDB-style file with coordinates for d3ljra1.
(The format of our PDB-style files is described here.)

Timeline for d3ljra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ljra2