SCOPe 2.07: Domain d5ggyn1: 5ggy N:55-318

Lineage for d5ggyn1 (5ggy N:55-318)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (40 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:345073] [330007] (2 PDB entries)

8. Domain d5ggyn1: 5ggy N:55-318 [330036]
   Other proteins in same PDB: d5ggya2, d5ggyn2
   automated match to d1efdn_
   complexed with cl

Details for d5ggyn1

PDB Entry: 5ggy, 2.5 Å

PDB Description: x-ray crystal structure of periplasmic desferal binding protein fhud from vibrio cholerae

PDB Compounds: (N:) Iron(III) ABC transporter, periplasmic iron-compound-binding protein

SCOPe Domain Sequences for d5ggyn1:

Sequence; same for both SEQRES and ATOM records:

>d5ggyn1 c.92.2.0 (N:55-318) automated matches {Vibrio cholerae [TaxId: 345073]}
rvvvlnwdlleqvlelgiqpvgapelssyvqwvvqpevpssvqdigtrtepnlekiaalk
pdvilaagpqqdllatlgriapvvylpnfseqdnaaqvaishfktlatlfgkeavaqqkl
eamyarfselkaslqhafgdtlpavvtlrfanptsvflytenstpqyvleqlglssalpq
ppkewgivqkrlselqhveqgyvlyflpfaeekkvqksvlwrampfvqagrvnsvrpvws
yggamslrysaeaitesllavapq

Timeline for d5ggyn1:

• d5ggyn1 first appeared in SCOPe 2.06
  
• d5ggyn1 appears in the current release, SCOPe 2.08