Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
Protein automated matches [190944] (40 species) not a true protein |
Species Vibrio cholerae [TaxId:345073] [330007] (2 PDB entries) |
Domain d5ggya1: 5ggy A:55-319 [330008] Other proteins in same PDB: d5ggya2, d5ggyn2 automated match to d1efdn_ complexed with cl |
PDB Entry: 5ggy (more details), 2.5 Å
SCOPe Domain Sequences for d5ggya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ggya1 c.92.2.0 (A:55-319) automated matches {Vibrio cholerae [TaxId: 345073]} rvvvlnwdlleqvlelgiqpvgapelssyvqwvvqpevpssvqdigtrtepnlekiaalk pdvilaagpqqdllatlgriapvvylpnfseqdnaaqvaishfktlatlfgkeavaqqkl eamyarfselkaslqhafgdtlpavvtlrfanptsvflytenstpqyvleqlglssalpq ppkewgivqkrlselqhveqgyvlyflpfaeekkvqksvlwrampfvqagrvnsvrpvws yggamslrysaeaitesllavapqs
Timeline for d5ggya1: