![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (239 species) not a true protein |
![]() | Species Burkholderia multivorans [TaxId:87883] [329907] (1 PDB entry) |
![]() | Domain d5unlb_: 5unl B: [329948] automated match to d4rf5a_ complexed with edo, no3 |
PDB Entry: 5unl (more details), 1.65 Å
SCOPe Domain Sequences for d5unlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5unlb_ c.2.1.0 (B:) automated matches {Burkholderia multivorans [TaxId: 87883]} sdllkpydglrvlvtggasgiglaiadafaecgarvhvcdasqaaiaaladrpsraaiga tladvsdraavervfadvaatlggldvlvnnagiagptggideidpaqweqtvainlnaq fefarravpllreskhggaiialssvagrlgyayrtpyaatkwavvglvkslaielgplg irvnaiqpgivrgprirrviearaqqlgigydemeqrylerislrrmtepaeiaatalfl cspgghgitgqaisvcgnvevl
Timeline for d5unlb_: