Lineage for d5gzzc1 (5gzz C:1-80)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) Protein Class alpha GST [81360] (8 species) 
Species Schistosoma japonicum [TaxId:6182] [52878] (15 PDB entries)
Uniprot P08515
Domain d5gzzc1: 5gzz C:1-80 [329735]
Other proteins in same PDB: d5gzzb2, d5gzzc2, d5gzzd2, d5gzze1, d5gzze2, d5gzzf1, d5gzzf2, d5gzzg2
automated match to d1m9aa2
complexed with gsh, jaa
Details for d5gzzc1
PDB Entry: 5gzz (more details), 2.39 Å
PDB Description: crystal structure of fin219-sjgst complex with ja
PDB Compounds: (C:) Glutathione S-transferase class-mu 26 kDa isozymeSCOPe Domain Sequences for d5gzzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gzzc1 c.47.1.5 (C:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn
SCOPe Domain Coordinates for d5gzzc1:
Click to download the PDB-style file with coordinates for d5gzzc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5gzzc1:
View in 3D
